PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN35393.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 252aa    MW: 27820 Da    PI: 8.7517
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN35393.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.82.4e-382080262
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                ++++l+cprC stntkfCyynnysl+qPry Ck+CrryWt+GG+lrnvPvGgg+rknk+++
  KHN35393.1 20 PQEQLNCPRCSSTNTKFCYYNNYSLTQPRYICKTCRRYWTEGGSLRNVPVGGGSRKNKRVT 80
                6899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-261578IPR003851Zinc finger, Dof-type
PfamPF027013.3E-332278IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.4812478IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102662IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MEDIGPNSCT RQVAEKKARP QEQLNCPRCS STNTKFCYYN NYSLTQPRYI CKTCRRYWTE  60
GGSLRNVPVG GGSRKNKRVT SSKVPPDLNP PSLSSVSAIS SQNPKMQGVH DLNLAFPTAM  120
DNYHGMSPYV EMPKLEIGGD HSTSHSHHHS PSAVELLRSG MASRGLNPYA PNSLMSTSDH  180
SLYTTGYPMQ EIKPNLSFSV DDGFGNRSYG VQENGGGRLL FPFGDIKHLS AGVEVEHIKE  240
RGNNSTGYWT GW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0966730.0BT096673.1 Soybean clone JCVI-FLGm-15N21 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006603760.10.0PREDICTED: dof18 isoform X1
RefseqXP_006603761.10.0PREDICTED: dof18 isoform X1
RefseqXP_006603759.10.0PREDICTED: dof18 isoform X1
RefseqXP_006603758.10.0PREDICTED: dof18 isoform X1
RefseqXP_006603757.10.0PREDICTED: dof18 isoform X1
SwissprotQ433859e-59DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLA0A0B2RSP10.0A0A0B2RSP1_GLYSO; Dof zinc finger protein DOF3.7
TrEMBLC6TGC30.0C6TGC3_SOYBN; Uncharacterized protein
STRINGGLYMA19G44670.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.46e-65Dof family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]